Protein Info for PfGW456L13_3923 in Pseudomonas fluorescens GW456-L13

Annotation: Nucleoside-diphosphate-sugar epimerases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01946: Thi4
  • amino acids 1 to 50 (50 residues), 28.7 bits, 1.9e-10
• PF01494: FAD_binding_3
  • amino acids 2 to 35 (34 residues), 26.1 bits, 1.3e-09
• PF01266: DAO
  • amino acids 4 to 354 (351 residues), 239.1 bits, E=2.7e-74
• PF00890: FAD_binding_2
  • amino acids 4 to 37 (34 residues), 22 bits, 2.2e-08
• PF13450: NAD_binding_8
  • amino acids 7 to 37 (31 residues), 25.3 bits, see alignment (E = 3.9e-09)

Best Hits

Swiss-Prot: 66% identical to PUUB_ECOLI: Gamma-glutamylputrescine oxidoreductase (puuB) from Escherichia coli (strain K12)

KEGG orthology group: K09471, gamma-glutamylputrescine oxidase [EC: 1.4.3.-] (inferred from 96% identity to pfo:Pfl01_1909)

MetaCyc: 66% identical to gamma-glutamylputrescine oxidase (Escherichia coli K-12 substr. MG1655)
1.4.3.M3 [EC: 1.4.3.M3]

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

MetaCyc Pathways

• superpathway of L-arginine and L-ornithine degradation (10/13 steps found)
• superpathway of ornithine degradation (6/8 steps found)
• putrescine degradation II (3/4 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (8/11 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.- or 1.4.3.M3

Sequence Analysis Tools

See A0A293QTD7 at UniProt or InterPro

Protein Sequence (400 amino acids)

>PfGW456L13_3923 Nucleoside-diphosphate-sugar epimerases (Pseudomonas fluorescens GW456-L13)
VETDVCVIGAGYTGLSAALFLLENGFKVTVLEAARVGFGASGRNGGQIVNSYSRDIDVIE
RTVGPKQAQLLGQMAFEGGRIIRERVARYNIQCDLKDGGVFAAMTAKQMGHLESQKRLWE
RFGHTQLELMDQRRIREVVACDQYVGGMLDMSGGHIHPLNLALGEAAAVESLGGTIYEQS
PAVRIERGASPVVHTPQGKVRAKFIIVAGNAYLGNLVPELAAKSMPCGTQVITTEPLGEE
LAKTLLPQDYCVEDCNYLLDYYRLSGDKRLIFGGGVVYGARDPANIEAIIRPKMLKAFPQ
LKDVKIDYAWTGNFLLTLSRLPQVGRLGDNIYYSQGCSGHGVTYTHLAGKVLAEALRGQA
ERFDAFADLPHYPFPGGQLLRTPFAALGAWYYGLRDKFGY