Protein Info for PfGW456L13_3909 in Pseudomonas fluorescens GW456-L13

Annotation: Ribose operon repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF00356: LacI" amino acids 1 to 42 (42 residues), 48 bits, see alignment 1.7e-16 PF00532: Peripla_BP_1" amino acids 54 to 300 (247 residues), 137.8 bits, see alignment E=1.1e-43 PF13407: Peripla_BP_4" amino acids 56 to 298 (243 residues), 73 bits, see alignment E=6e-24 PF13377: Peripla_BP_3" amino acids 163 to 322 (160 residues), 135.5 bits, see alignment E=4.1e-43

Best Hits

Swiss-Prot: 44% identical to PURR_ALISL: HTH-type transcriptional repressor PurR (purR) from Aliivibrio salmonicida (strain LFI1238)

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 91% identity to pfo:Pfl01_1922)

Predicted SEED Role

"Ribose operon repressor" in subsystem D-ribose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QTM5 at UniProt or InterPro

Protein Sequence (333 amino acids)

>PfGW456L13_3909 Ribose operon repressor (Pseudomonas fluorescens GW456-L13)
VAALAGISYTTVSHVVNKTRPVSEEVRIKVEAAIQTLDYVPSAVARSLKAKTTATIGLLV
PNSLNPYFAELARGIEDYCERNGYCVILCNSDDNPDKQRSYLRVLLEKRIDGLIVASAGG
DSGLAQGLKGVRTPMVIVDRGLDGVDADLVRIDHEYGAYLATRHLLELGHRDIATISGPQ
STSVAQMRLAGYRRALKEAGVEVSPGRMLESDFTSTGGYSAAAILLESNPPTAVFAANDM
IGIGVLRAAAERNIRVPSELSVIGFDDIQMSRYVYPSLTTVGQSILQLGEMAAEVLLRRI
ATPGLATDQRIVTPSIVMRESTAPLASVFAQFR