Protein Info for PfGW456L13_3899 in Pseudomonas fluorescens GW456-L13

Annotation: Translation initiation factor 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00168: translation initiation factor IF-3
  • amino acids 1 to 142 (142 residues), 182.6 bits, E=2.2e-58
• PF05198: IF3_N
  • amino acids 1 to 45 (45 residues), 62.7 bits, E=3.1e-21
• PF00707: IF3_C
  • amino acids 55 to 140 (86 residues), 122.5 bits, E=5.7e-40

Best Hits

Swiss-Prot: 68% identical to IF3_CHRVO: Translation initiation factor IF-3 (infC) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 95% identity to pfo:Pfl01_1932)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

See A0A0P9BEU2 at UniProt or InterPro

Protein Sequence (143 amino acids)

>PfGW456L13_3899 Translation initiation factor 3 (Pseudomonas fluorescens GW456-L13)
VSIEDALLKAEEAKLDLVEISADAVPPVCKLMDYGKSIFEKKKQIAAAKKNQKQIQVKEI
KFRPGTEEGDYQVKLRNLVRFLSDGDRAKVSLRFRGREMAHQELGMELLKRVEGDLLEYG
SVEQHPKMEGRQLIMVIAPKKKK