Protein Info for PfGW456L13_387 in Pseudomonas fluorescens GW456-L13

Annotation: RhtB family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 69 (30 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 148 to 174 (27 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details PF01810: LysE" amino acids 16 to 204 (189 residues), 118.4 bits, see alignment E=1.4e-38

Best Hits

KEGG orthology group: None (inferred from 72% identity to pba:PSEBR_a2919)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QH47 at UniProt or InterPro

Protein Sequence (209 amino acids)

>PfGW456L13_387 RhtB family transporter (Pseudomonas fluorescens GW456-L13)
MPDTTNLYLFIVAALLLLIVPGPNMAIVSSHAVAHGWRAGLAAALGITLADVLMTVMVSA
GLGVLVMSWAPAFDLLRWAGACYLMLLAWQALKTSTSDTESQATQASLKKIFVRATLNSL
LNPKALLFFMVFLPQFVTVGTSSVTSQLMFLGLLLALIALIFHSLLGFCAGQLHVRFREG
MISKRLGAYSFAAVMTALAARLLLLDRPF