Protein Info for PfGW456L13_3862 in Pseudomonas fluorescens GW456-L13

Annotation: DoxX family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details PF07681: DoxX" amino acids 14 to 96 (83 residues), 51 bits, see alignment E=9.7e-18

Best Hits

KEGG orthology group: None (inferred from 78% identity to pba:PSEBR_a3601)

Predicted SEED Role

"DoxX family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QR63 at UniProt or InterPro

Protein Sequence (138 amino acids)

>PfGW456L13_3862 DoxX family protein (Pseudomonas fluorescens GW456-L13)
MDTSRSDDRAQDWGLLFLRVSGGLFLLWVHGLPKLLHYSAELQNIEDPFHLGTNLTLMLA
IFAEVVCPLLIVAGLLARLACLPILFLLWVSMLIVHPQWTLFEGQFGWLLLIVFTSIFIA
GPGRLALNVRFAGALRYV