Protein Info for PfGW456L13_3858 in Pseudomonas fluorescens GW456-L13

Annotation: cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 36 to 57 (22 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 152 to 218 (67 residues), 59.2 bits, see alignment E=3.4e-20 PF00027: cNMP_binding" amino acids 348 to 433 (86 residues), 46.8 bits, see alignment E=2.4e-16

Best Hits

KEGG orthology group: None (inferred from 86% identity to pfo:Pfl01_1968)

Predicted SEED Role

"cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QTR4 at UniProt or InterPro

Protein Sequence (475 amino acids)

>PfGW456L13_3858 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases (Pseudomonas fluorescens GW456-L13)
MSLLLEHLLSLSALLLVIDALLWHLAPFKHRVSRVGVRLALFVLFSAVLINAGVSPLQAP
LFADDRVAQLGATALGILWWLYVARVLTEVIGLALMRRIGHSGRLLQDVIGALVFLIAVV
AAAGYVLELPVKGLLATSGVVAIVVGLALQSTLSDVFSGIVLNTTKPYQVDDRVSIDGIE
GKVLDIDWRATHLLTSAGSTAVVPNSVAAKAKIVNLSRPFNMHGVSISIQVPNHIRPRRV
LDALDRTLQGSSSLLLDPAPKAVLKEAGETMSEYVASGFIAELGKKGEVRNQLFDLAHRH
LEAAGISRQPDGVIEPSTRARALLDEVKIFRSLSAEERDHLAQNMVAQQYAAGEVVLDLD
EVPDSLFVIATGVVSATVPNGSTQIEAGRMGPSEVMGEQSILADTPSQARFTAMTSSIIY
RLDKSLTRNCMAQRREVDRALNKLQAVRQQNSRMALMAKPVAVRKGGFLSWLQSR