Protein Info for PfGW456L13_3834 in Pseudomonas fluorescens GW456-L13

Annotation: diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details PF02743: dCache_1" amino acids 58 to 281 (224 residues), 48.3 bits, see alignment E=1.4e-16 PF22588: dCache_1_like" amino acids 196 to 281 (86 residues), 68.7 bits, see alignment E=5.9e-23 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 345 to 512 (168 residues), 169.6 bits, see alignment E=2.4e-54 PF00990: GGDEF" amino acids 350 to 508 (159 residues), 156.2 bits, see alignment E=9.4e-50

Best Hits

KEGG orthology group: None (inferred from 66% identity to pfl:PFL_4715)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QRJ2 at UniProt or InterPro

Protein Sequence (514 amino acids)

>PfGW456L13_3834 diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (Pseudomonas fluorescens GW456-L13)
MVHPSINDHIEMLRPAVPRLKVRSAVILLLAVCLSMVAIVIWEAWSSRQYYLHDKEVTMS
NLAQTLASQAQATIKQADTLLFTLVDRLEHEGVDQSRLPALLNAQRSELSQLHGVFVFDE
KGQWIANSNGAGQTGVNNSDREYFTFHRDNPSRGPHIGPSIKSRSSGEWIMTVSRRFNHP
DGSFAGVAVATIYLSHFLQLYDSIDMGSNGVINLIGDNARIVIRRPFKEAEIGSSLAKSP
LFNELLPKGDAGTATLRSIVDGVERVTGYRRVEGYPLIVFTAVNKNEVLGSWRKETLLSA
GIVTLLLGFLGVLGFRLIKLMRQQNLVQVELLDTQDKLLEVNRNLEGLALKDALTGLANR
RQLDAFIDAEMGRARRSQSELALLMIDVDHFKPFNDCYGHLAGDECLRKVSAIITNSIKR
PGDLAARYGGEEFAVVLPGSDYVGAFLVAEKIRRAVLQADIAHSDSPEGIVTVSVGVCAS
NAASQVRPEDLIGAADKALYVAKASGRNMSVIAN