Protein Info for PfGW456L13_3825 in Pseudomonas fluorescens GW456-L13

Annotation: Aromatic hydrocarbon utilization transcriptional regulator CatR (LysR family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00126: HTH_1" amino acids 3 to 61 (59 residues), 81.2 bits, see alignment E=4.3e-27 PF03466: LysR_substrate" amino acids 92 to 289 (198 residues), 126.4 bits, see alignment E=1e-40

Best Hits

Swiss-Prot: 71% identical to CATR_PSEPU: HTH-type transcriptional regulator CatR (catR) from Pseudomonas putida

KEGG orthology group: None (inferred from 84% identity to pfs:PFLU5192A)

Predicted SEED Role

"Aromatic hydrocarbon utilization transcriptional regulator CatR (LysR family)" in subsystem DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QNP9 at UniProt or InterPro

Protein Sequence (295 amino acids)

>PfGW456L13_3825 Aromatic hydrocarbon utilization transcriptional regulator CatR (LysR family) (Pseudomonas fluorescens GW456-L13)
MELRHLRYFQVLAQTLNFTRAAELLHIAQPPLSRQIQQLEDELGVMLLERGRPLKLTDAG
RFFHEHSTALLEQLNKVCDNTRRIGLGEKTWLGIGFAPSTLYGVLPELIRRLRSGEPLEL
ELGLSEMTTLQQVQALKAGRIDIGFGRIRIDDPAIVQTVLTEDRLVAALPAGHPLLAGPI
SLRELAKEPFVLYPGNPRPSYADHVIALFESYGVSIHVAQWTNELQTAIGLVGAGIGVTL
VPASVQLLHRDDIGFTPLLEDNATSPIILSRRVGDVSPGLNHCLRMIDELLPPAA