Protein Info for PfGW456L13_3751 in Pseudomonas fluorescens GW456-L13

Annotation: Flavodoxin reductases (ferredoxin-NADPH reductases) family 1; Vanillate O-demethylase oxidoreductase (EC 1.14.13.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 108 to 127 (20 residues), see Phobius details PF22290: DmmA-like_N" amino acids 97 to 207 (111 residues), 34 bits, see alignment E=3.6e-12 PF00111: Fer2" amino acids 235 to 307 (73 residues), 45.9 bits, see alignment E=4.4e-16

Best Hits

Swiss-Prot: 46% identical to VANB_PSES9: Vanillate O-demethylase oxidoreductase (vanB) from Pseudomonas sp. (strain ATCC 19151)

KEGG orthology group: None (inferred from 61% identity to hse:Hsero_1339)

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1; Vanillate O-demethylase oxidoreductase (EC 1.14.13.-)" (EC 1.14.13.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QRB0 at UniProt or InterPro

Protein Sequence (316 amino acids)

>PfGW456L13_3751 Flavodoxin reductases (ferredoxin-NADPH reductases) family 1; Vanillate O-demethylase oxidoreductase (EC 1.14.13.-) (Pseudomonas fluorescens GW456-L13)
MMKVKIERIVDEALDIRSFRLVRSDGQPLDTYEPGAHVDLTGPTGVTRQYSLCSPPQDRR
AYLVAVKKEAQSRGGSLALHEQVEEGMELEMGAPRNLFRLDDSAREHVLFAAGIGVTPLL
SMAYRLAESGQPYRLHYFARSAQYAAFTELLATKFADHVEFHYGVEPADLDGALSECLAR
AGSAAHVYTCGPAPFMNKVVEVASRSRSDDSIHLEHFAADPAANSAPAGTFEVELASSGV
VLQVPANASLVDVLQAHGCDIDTECREGICGTCIVEVLDGVPEHRDNCLSNKEKASNKQI
CACVSRALSARLVLDI