Protein Info for PfGW456L13_3750 in Pseudomonas fluorescens GW456-L13

Annotation: Transcriptional activator feaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF14525: AraC_binding_2" amino acids 15 to 183 (169 residues), 76.1 bits, see alignment E=4.6e-25 PF12833: HTH_18" amino acids 222 to 302 (81 residues), 64.4 bits, see alignment E=1.5e-21 PF00165: HTH_AraC" amino acids 268 to 301 (34 residues), 35.8 bits, see alignment 9.6e-13

Best Hits

KEGG orthology group: None (inferred from 55% identity to pmk:MDS_2857)

Predicted SEED Role

"Transcriptional activator feaR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QSV7 at UniProt or InterPro

Protein Sequence (305 amino acids)

>PfGW456L13_3750 Transcriptional activator feaR (Pseudomonas fluorescens GW456-L13)
MITASTVRNEAFESWLSQVNQACGRFDARALDTDFYGELAEFRSGAINLSVVDMAHVHLY
RTSKDVSTSSDGHYYAVFQMRGSSQLEQGDNRAQLGCGDIALIDASRPSDMIYNDDCRQL
SLILPRQVVERGSHLNAVNCATRIAAGSPLAAMANKLVLDTRQQEGLDMQESEAVLDALA
SLLLPGISARDGGADAHERQFRKIIAFIDAHLSDEELCPELIAREVGISVRGLYRMFSKR
GLVVAQYIKHRRLDFCAENLRRADVEQKLSALCYAWGFSDSSYFSSAFKSRFGVSPGAYR
KRYSC