Protein Info for PfGW456L13_3748 in Pseudomonas fluorescens GW456-L13

Annotation: 4-hydroxyphenylacetate 3-monooxygenase, reductase component (EC 1.6.8.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 TIGR02296: 4-hydroxyphenylacetate 3-monooxygenase, reductase component" amino acids 11 to 163 (153 residues), 224.8 bits, see alignment E=2.5e-71 PF01613: Flavin_Reduct" amino acids 15 to 163 (149 residues), 130.2 bits, see alignment E=3.5e-42

Best Hits

Swiss-Prot: 62% identical to HPAC_PSEAE: 4-hydroxyphenylacetate 3-monooxygenase reductase component (hpaC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00484, 4-hydroxyphenylacetate-3-hydroxylase small chain [EC: 1.14.13.3] (inferred from 69% identity to hse:Hsero_1338)

MetaCyc: 53% identical to HpaC (Escherichia coli W)
RXN-12446 [EC: 1.5.1.36]

Predicted SEED Role

"4-hydroxyphenylacetate 3-monooxygenase, reductase component (EC 1.6.8.-)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic Amin Catabolism (EC 1.6.8.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.8.-

Use Curated BLAST to search for 1.14.13.3 or 1.5.1.36 or 1.6.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QQV4 at UniProt or InterPro

Protein Sequence (169 amino acids)

>PfGW456L13_3748 4-hydroxyphenylacetate 3-monooxygenase, reductase component (EC 1.6.8.-) (Pseudomonas fluorescens GW456-L13)
MADLSQQQIDFRNAMAQLPAAVNIITTNGPGGRCGITASAVCSVTDSPPTVLVCVNRNSA
THDVFRTNGHLCVNVLCGEQEELARHFAGMTQVPMAERFAWDLWDDGAADVPVLRDALVQ
LEGRISECKEVGSHSVMFVELTKVGVREPRDSLVYFNRLFHRVEHASAA