Protein Info for PfGW456L13_3743 in Pseudomonas fluorescens GW456-L13

Annotation: Chemotactic transducer

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 708 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 355 to 376 (22 residues), see Phobius details PF00672: HAMP" amino acids 375 to 427 (53 residues), 59.4 bits, see alignment 3.5e-20 PF00015: MCPsignal" amino acids 491 to 673 (183 residues), 141.7 bits, see alignment E=2.2e-45

Best Hits

KEGG orthology group: None (inferred from 47% identity to pmk:MDS_2875)

Predicted SEED Role

"Chemotactic transducer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QNG2 at UniProt or InterPro

Protein Sequence (708 amino acids)

>PfGW456L13_3743 Chemotactic transducer (Pseudomonas fluorescens GW456-L13)
MHRTFLTIQSKIALLAGLCLLLVVGLLMGLSLYQTHKSSRQVTEASGDMLANAAREHMQA
LGKVQAMQVQRTFMQTHEYGQGLSRYLLYLRQLQHQGSLTRPQLRQELSTQLHQALIDKP
DLLGLYVIFEPGALDGADAGFANQAELGSNETGRFALYWVQSKPGELQAVIGDEGLLANT
EPGPSGAPYNAFYTCARDTGQACVLEPYFDEASGSRKLVTSVAFPLLENGKVIAVVGLDI
NLAALQHNSEASARELFDGNGQISIVSPRGVISANSQDVGRLGQPMDNAEVMDSLRQGQP
KVFVDARQIKVLEPLAPIAGAAPWGVLVGVPQNVLLAPVTTLQNELDAQGVQSTALELLL
GGGSALLGLLLIWYTAQRITRPLQALTRVMEDISLGEGDLTRRLQVQSRDEIGQLATAFN
RFIERIHHSIREVSSAALGVNEGARRVLDASNSSMSNFDDQSTRTNSVAAAINQLGAAAQ
EIAHNASDASQQASSARQQAEDGRQVVQRTIEVMNELSGKISASCANIEVLNDKTVNIGQ
ILEVIKGISQQTNLLALNAAIEAARAGEAGRGFAVVADEVRSLAGRTQASALEIQQMIEE
LQVGARESVTTMTESQRHSEESVTIANLAGSRLGSVTQRIGEIDNVNQSVAAATEEQTAV
VEALNVDITQINTLNRQGVENLQSTLRACTELEQQAGRLNQLVGSFRI