Protein Info for PfGW456L13_369 in Pseudomonas fluorescens GW456-L13

Annotation: Putative membrane protein YfcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 69 to 86 (18 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 185 to 209 (25 residues), see Phobius details amino acids 221 to 239 (19 residues), see Phobius details PF01925: TauE" amino acids 2 to 237 (236 residues), 177 bits, see alignment E=2.5e-56

Best Hits

Swiss-Prot: 42% identical to YCB9_SINSX: Probable membrane transporter protein ORF9 from Sinorhizobium sp.

KEGG orthology group: K07090, (no description) (inferred from 70% identity to pay:PAU_01511)

Predicted SEED Role

"Putative membrane protein YfcA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QE53 at UniProt or InterPro

Protein Sequence (261 amino acids)

>PfGW456L13_369 Putative membrane protein YfcA (Pseudomonas fluorescens GW456-L13)
MLALVAFFAGFFDAIAGGGGLITLPALFLAGVDPISAIATNKFQAASATVSATVTFARKG
MIEWREGRFLVICGFVGGASGALLVSTIDKRYLEVCVPIMLILVAIYFALSPKLANEDRR
KRISVLFFSFSVAPILGFYDGIFGPGVGSFFIVGFVLLCGLGMMRAMSFTKLANASCNLG
SLSVFITKGVIIWPIAIAMALAAFIGAQLGARAAVRVGPRLIKPMLIVVCCALAIKLLSV
ETNPLRVALIQAYAGVNHDKP