Protein Info for PfGW456L13_3675 in Pseudomonas fluorescens GW456-L13

Annotation: Alternative cytochrome c oxidase polypeptide CoxP (EC 1.9.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 transmembrane" amino acids 49 to 70 (22 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 169 to 197 (29 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details PF00510: COX3" amino acids 48 to 237 (190 residues), 86.4 bits, see alignment E=1.5e-28

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 78% identity to har:HEAR1118)

Predicted SEED Role

"Alternative cytochrome c oxidase polypeptide CoxP (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QSY9 at UniProt or InterPro

Protein Sequence (237 amino acids)

>PfGW456L13_3675 Alternative cytochrome c oxidase polypeptide CoxP (EC 1.9.3.1) (Pseudomonas fluorescens GW456-L13)
MALHPQAQVESSSSNPPGSPPAPGWQGIASDWSSDKEAFKQVPWGKAMMWIFLLSDTFIF
TCFLTGYMSVRMTITSAWPNPSEVFALTIGGKEIPLILIAIMTFVLISSSGTMAMAVNFA
YRRNRAKTAALMLATAALGVTFVSMQAFEWSKLIAEGVRPWGNPMGAAQFGASFFMITGF
HGLHVSIGALYLSIVALKVWRGDYERSGNYQNVEIAGLYWHFVDLVWVFIFAFFYLW