Protein Info for PfGW456L13_3665 in Pseudomonas fluorescens GW456-L13

Annotation: Lipase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF20434: BD-FAE" amino acids 88 to 197 (110 residues), 61.6 bits, see alignment E=8.3e-21 PF07859: Abhydrolase_3" amino acids 103 to 309 (207 residues), 247.1 bits, see alignment E=1.6e-77

Best Hits

KEGG orthology group: K01066, esterase / lipase [EC: 3.1.1.-] (inferred from 88% identity to psp:PSPPH_3647)

Predicted SEED Role

"Lipase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-

Use Curated BLAST to search for 3.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QS39 at UniProt or InterPro

Protein Sequence (337 amino acids)

>PfGW456L13_3665 Lipase (Pseudomonas fluorescens GW456-L13)
MNVLTKTLVGSLLALSIGNAFADSGVEHNTQAFLDALNSGSGKPIEQLSPKDARAVLTGA
QAGVKLTLPKADVSEKTITVDGQDISLTIVRPAGVKGTLPVFMYFHGGGWVLGDFPTHER
LVRDLVVGSGAAAVFVNYTPSPEAHYPTAINQAYGATKWVAEHGKEINVDGKRLAVAGNS
VGGNMAAVVSLMAKDKGTPAIKYQVLLWPVTDANFETASYNQYAEGHFLTKNMMKWFWDN
YTTDPKQCAEIYASPLRATTEQLKGLPPALVQTASADVLRDEGEAYARKLDQAGVPVTAV
RYNGMIHDYGLLNVVSQVPAVRSAMLQASEELKVHLK