Protein Info for PfGW456L13_366 in Pseudomonas fluorescens GW456-L13

Annotation: A/G-specific adenine glycosylase (EC 3.2.2.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR01084: A/G-specific adenine glycosylase" amino acids 5 to 277 (273 residues), 366 bits, see alignment E=7.1e-114 PF00730: HhH-GPD" amino acids 35 to 167 (133 residues), 78.6 bits, see alignment E=6.5e-26 PF00633: HHH" amino acids 100 to 128 (29 residues), 27.5 bits, see alignment (E = 2.9e-10) PF14815: NUDIX_4" amino acids 238 to 343 (106 residues), 74.2 bits, see alignment E=1.1e-24

Best Hits

Swiss-Prot: 52% identical to MUTY_SALTY: Adenine DNA glycosylase (mutY) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 95% identity to pfo:Pfl01_0320)

MetaCyc: 53% identical to adenine DNA glycosylase (Escherichia coli K-12 substr. MG1655)
RXN0-2661 [EC: 3.2.2.31]

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.- or 3.2.2.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QJD5 at UniProt or InterPro

Protein Sequence (355 amino acids)

>PfGW456L13_366 A/G-specific adenine glycosylase (EC 3.2.2.-) (Pseudomonas fluorescens GW456-L13)
MRAEQFSTAVLDWFDRHGRHDLPWQQDINPYRVWVSEIMLQQTQVSTVLNYFDRFMASLP
TVQALACAPEDEVLHLWTGLGYYTRARNLQKTAKIVVEQYGGEFPRDVEKLTDLPGIGLS
TAGAIASISMGLRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWANAERFTPQTRVNAY
TQAMMDLGATLCTRSKPSCLLCPLEKGCEAHMLGLETRYPIPKPRKAIPQKRTLMPMLAN
AEGAILLYRRPSTGLWGGLWSLPELDDLDDLPHLASQHSLELGTQQALPSLVHTFSHFQL
SIEPWLVQVQESGHHVAEADWLWYNLATPPRLGLAAPVKTLLERAAAVLNAGESS