Protein Info for PfGW456L13_3657 in Pseudomonas fluorescens GW456-L13

Annotation: Threonine dehydrogenase and related Zn-dependent dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 157 to 173 (17 residues), see Phobius details PF08240: ADH_N" amino acids 27 to 114 (88 residues), 60.4 bits, see alignment E=1.8e-20 PF00107: ADH_zinc_N" amino acids 164 to 300 (137 residues), 55.5 bits, see alignment E=5.8e-19

Best Hits

KEGG orthology group: None (inferred from 42% identity to nfa:nfa33970)

Predicted SEED Role

"Threonine dehydrogenase and related Zn-dependent dehydrogenases" in subsystem Threonine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QQM2 at UniProt or InterPro

Protein Sequence (339 amino acids)

>PfGW456L13_3657 Threonine dehydrogenase and related Zn-dependent dehydrogenases (Pseudomonas fluorescens GW456-L13)
MNHVMKQVRLHGPRDLRVDEVPLPSPGETDVLVEVAACGVCGSDLGFYESGGIRRDGAPM
PLGHEFSGVIREVGTAVVHYRPGMRVVVNPMANGAMIGVGSDEGALANLVRVRNVNSGPI
LHQLPANLPLEVAALVEPLAVALHAVNRSRVTAGESVLVLGAGAIGLGIVACLKARGISQ
IAVADLSAGRLEIAAGLGANLTLDPTRDDLWSELARAHGSVPTFLGTQAPATQVIFECSG
VSGVLHEAIARARDAARITVASVYKQPQAFDFSILQVKELELIGTLCYPTEFAQALELLA
SGAFDPESMISHRFSLDDVAQAYKTAADPQRSAKVIIKP