Protein Info for PfGW456L13_3656 in Pseudomonas fluorescens GW456-L13

Annotation: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00106: adh_short" amino acids 8 to 188 (181 residues), 125.1 bits, see alignment E=3.8e-40 PF13561: adh_short_C2" amino acids 14 to 244 (231 residues), 188.9 bits, see alignment E=1.7e-59 PF08659: KR" amino acids 16 to 181 (166 residues), 30.9 bits, see alignment E=3.8e-11

Best Hits

KEGG orthology group: None (inferred from 70% identity to req:REQ_46890)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QS29 at UniProt or InterPro

Protein Sequence (268 amino acids)

>PfGW456L13_3656 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Pseudomonas fluorescens GW456-L13)
MSKRLEGKAALVLGVAPGNVGEAVARRYVEQGARVLVSGRRADAVAAVAQSLGVPWLACD
ITSQVEVDDLVAQSNQCLNGLDIGVNATGWGLLKPFLEHSREDLEKMNAVQFTGPFQYFQ
ALLRHMPTGGSIIQISSVTASIMFDNHAAYMGTKAGIDHVIRCIAHEFGQHGIRANSIAP
GGVADAPMSGGGLLNPSIAALYHREIPLGRSGVSADVADAALWLASNESSFVTGQVIHVS
GGQTLRRNPSISEIYAAATAPAGPARHL