Protein Info for PfGW456L13_3649 in Pseudomonas fluorescens GW456-L13

Updated annotation (from data): D-serine permease
Rationale: Specific phenotype: utilization of D-Serine
Original annotation: D-serine permease DsdX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 7 to 23 (17 residues), see Phobius details amino acids 29 to 49 (21 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 104 to 133 (30 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 259 to 284 (26 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 344 to 370 (27 residues), see Phobius details amino acids 386 to 408 (23 residues), see Phobius details amino acids 424 to 443 (20 residues), see Phobius details PF02447: GntP_permease" amino acids 7 to 443 (437 residues), 499.4 bits, see alignment E=8.6e-154 TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 7 to 446 (440 residues), 484.2 bits, see alignment E=2.1e-149 PF03600: CitMHS" amino acids 19 to 376 (358 residues), 46.7 bits, see alignment E=2.5e-16

Best Hits

KEGG orthology group: K03299, gluconate:H+ symporter, GntP family (inferred from 69% identity to ppf:Pput_3069)

Predicted SEED Role

"D-serine permease DsdX" in subsystem Glycine and Serine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QT99 at UniProt or InterPro

Protein Sequence (446 amino acids)

>PfGW456L13_3649 D-serine permease (Pseudomonas fluorescens GW456-L13)
MHSGPTLLVVLFSAIILIVFLIVKVRVHAFLALTAASFVVGIGSGMPLAQMASSYEKGVG
GTLGFLATIIGLGGILGKMLEESGGAERIAQTLLSTLGKERASWAMMLVGFIAGIPVFFE
VGFVLLIPLIYVVAKETRINLLYLGVPLAVSLMAVHCMLPPHPAAMAITGLLGADVGKVI
VYGLIIALPTAIIAGPLWIKLVCKSEAPDTQEAFLDEHCVDSATRDLPGLGLTLLTILLP
LLLMVGKSFAAGLPHDSGLFSIVSFLGTPLIALSIAVVFAYWALGLRRGLSMPDLLAHTQ
KSFPPLASILLIIGAGGAFNGILVDSGVGNALSGSLTQLNMNPIVLAWLVAGLMHFAVGS
ATVAMISAAGMVMPMLSAHPTVSKEIICIAIGAGAIGWTHVTDSAFWVVKEYLGVSLAEA
LKKFTSATVLASLIALGLTLLLSQFV