Protein Info for PfGW456L13_3646 in Pseudomonas fluorescens GW456-L13

Annotation: Transporter, LysE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 41 to 66 (26 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details PF01810: LysE" amino acids 20 to 205 (186 residues), 90 bits, see alignment E=7.5e-30

Best Hits

KEGG orthology group: None (inferred from 70% identity to pfl:PFL_2679)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QXQ1 at UniProt or InterPro

Protein Sequence (209 amino acids)

>PfGW456L13_3646 Transporter, LysE family (Pseudomonas fluorescens GW456-L13)
VGDAMTFSVFVAFWAVSFLFVVTPGADWAYAISAGLKHRVVIPAVGGLLSGHLIATLVVA
AGVGTLVANHPGVMSVLTVAGAGYLLWLGINMLTRPSTPHTDEVQASGSWLRWALKGLCV
SGLNPKVFLLFLALLPQFADATAPWPVPTQMIALGLVHTVSCGVIYLLVGFGSQVVLKAR
PAAAQWVSRFSGATMIIIAVTLFTEQMPA