Protein Info for PfGW456L13_3645 in Pseudomonas fluorescens GW456-L13

Annotation: Transcriptional regulator, AsnC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 PF13412: HTH_24" amino acids 2 to 46 (45 residues), 74.2 bits, see alignment E=1.3e-24 PF12840: HTH_20" amino acids 2 to 47 (46 residues), 30.4 bits, see alignment E=7.6e-11 PF13404: HTH_AsnC-type" amino acids 2 to 42 (41 residues), 67.1 bits, see alignment E=2.4e-22 PF09339: HTH_IclR" amino acids 14 to 47 (34 residues), 22.7 bits, see alignment 1.7e-08 PF01037: AsnC_trans_reg" amino acids 75 to 141 (67 residues), 64.9 bits, see alignment E=1.3e-21

Best Hits

Swiss-Prot: 41% identical to PUTR_RHOCA: Proline dehydrogenase transcriptional activator (putR) from Rhodobacter capsulatus

KEGG orthology group: None (inferred from 83% identity to pfl:PFL_2680)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QS19 at UniProt or InterPro

Protein Sequence (150 amino acids)

>PfGW456L13_3645 Transcriptional regulator, AsnC family (Pseudomonas fluorescens GW456-L13)
VDRTDRKILAELQKDGRLSVTELAERVGLSLSPCHRRVRALEDSGVLLGYRAQLDPGALG
LNFSAMVFATLREGDRQAVEAFEAALIELPQVVDAQRLFGEPDYLLHVIAQDLPAFQRLY
DESLSTLPNVQRLTSTLVMKRVIQDRPLPL