Protein Info for PfGW456L13_3637 in Pseudomonas fluorescens GW456-L13

Annotation: Dicarboxylate carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 6 to 36 (31 residues), see Phobius details amino acids 47 to 70 (24 residues), see Phobius details amino acids 93 to 124 (32 residues), see Phobius details amino acids 135 to 159 (25 residues), see Phobius details amino acids 171 to 196 (26 residues), see Phobius details amino acids 261 to 292 (32 residues), see Phobius details amino acids 304 to 329 (26 residues), see Phobius details amino acids 342 to 373 (32 residues), see Phobius details amino acids 379 to 398 (20 residues), see Phobius details amino acids 425 to 447 (23 residues), see Phobius details PF07158: MatC_N" amino acids 1 to 149 (149 residues), 205.7 bits, see alignment E=3.6e-65 PF03600: CitMHS" amino acids 17 to 389 (373 residues), 89.2 bits, see alignment E=3.1e-29

Best Hits

Predicted SEED Role

"Dicarboxylate carrier protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QQK5 at UniProt or InterPro

Protein Sequence (450 amino acids)

>PfGW456L13_3637 Dicarboxylate carrier protein (Pseudomonas fluorescens GW456-L13)
MNNEILSILVLVVIFGIASVLPINMGALAFAAVFIVGSVIMDMTPATIFAGFPSDLFLTL
VGVTYLFGIAQNNGTIDWLIERAVLMVRGHVAWIPWVMFVVAALLTGFGALSPAVAAILA
PIALNFAVQYRINPVLMGLMVIHGAQGGSFSPVSIFGGITNQIVASSGLPYAPFTLFIAS
LLFNLGIAMVVFVVFGGLRSARLSLVVVPSGPELHAAGASLAILGHGGTPASPAYHRTDL
TGAGAPLHTLSGLDGAKLSTLVGLLALAISALVFKFNIGLVAMTVAVVLAMFAPKAQKAA
IDKVSWSTVLLITGIITYIGVMQTIGTIDYVAHGISGLGEPLLVALLLCFTAAIISSFAS
STALLGVIIPLAVPFLSQGHISAVGVVAAIAISTTIVDTSPFSTNGALVVANTPPLEREK
VLRSLLIYSAVVALVGPCVAWLTLVVPGVL