Protein Info for PfGW456L13_3635 in Pseudomonas fluorescens GW456-L13

Annotation: L-carnitine dehydratase/bile acid-inducible protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 168 to 181 (14 residues), see Phobius details PF02515: CoA_transf_3" amino acids 4 to 369 (366 residues), 414.3 bits, see alignment E=2.4e-128

Best Hits

KEGG orthology group: K07749, formyl-CoA transferase [EC: 2.8.3.16] (inferred from 81% identity to bxe:Bxe_B2997)

Predicted SEED Role

"L-carnitine dehydratase/bile acid-inducible protein F"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.16

Use Curated BLAST to search for 2.8.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293Q313 at UniProt or InterPro

Protein Sequence (409 amino acids)

>PfGW456L13_3635 L-carnitine dehydratase/bile acid-inducible protein F (Pseudomonas fluorescens GW456-L13)
MQAMQGVKIVDLSRALSGPFCTMVLADLGADVIKIEPGPTGDMSRTWGPFDRGVSTYYLS
CNRNKRGMCIDLRTPEGLTTIQQLIDDADVVIENFKPGTLESMGLGYEVLSARNPRLVLG
SINAFGADGPMSSWPGFDQIAQGYSGLMSLTGFVDGDPTRTGTAIGDLTSGMWLVTAVLA
ALLERERTGRGQHVSTSLLASLVGLLSVHGQRYLSLGDVPRRTGNAHSVIAPYGVFQTKD
GPLNLAPITSAMWGRLCILLDLPELPDDSRFATNEARVERRDELREILESRLKTRSKREW
TSLFVDAGLPAGPINTLDEVFDDPQVLHSQLTETLTHPTLGALRQVVTPVFCANDSVVSR
PPPLLGEHTVEVLREAGFDAASINALLAAKIVFQNSDDMTGAQSTGAAQ