Protein Info for PfGW456L13_3619 in Pseudomonas fluorescens GW456-L13

Annotation: Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 PF00266: Aminotran_5" amino acids 22 to 289 (268 residues), 40.3 bits, see alignment E=1e-14

Best Hits

KEGG orthology group: None (inferred from 94% identity to pen:PSEEN2741)

Predicted SEED Role

"Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase" in subsystem Serine-glyoxylate cycle

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QSH0 at UniProt or InterPro

Protein Sequence (377 amino acids)

>PfGW456L13_3619 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase (Pseudomonas fluorescens GW456-L13)
MSKLYPSIDPEGLVEYSVVYTDRSLNHMSQSFQGVMKNISKTLKQVYNAQAVAVVPGSGT
FGMEAVARQFATGQQCLVIRNGWFSYRWSQILEMGNIPAATTVLKARPVDTGRQAAYAPP
PLDEVLAAIAAQKPQIVFAPHVETSSGIILPDEYLRAVGDAVHAVGGLFVLDCIASGTIW
VDMHKCAVDLLISAPQKGWSASPCCALVMLSALALERIEQTQSSSFACDLKKWLQIMQAY
EQGGHAYHATMPSDSLARFNEVMKETQAYGFDKVRGEQQALGDRVRAMLTGKGIKSVAAA
GFQAPGVVVSYTDDADIKSGKKFASLGLQIAAGVPLQCDEPADFQTFRIGLFGLEKLHNI
ERTVSTLEKALDEVMDN