Protein Info for PfGW456L13_3603 in Pseudomonas fluorescens GW456-L13

Annotation: Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 signal peptide" amino acids 1 to 8 (8 residues), see Phobius details amino acids 27 to 35 (9 residues), see Phobius details transmembrane" amino acids 9 to 26 (18 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 196 to 220 (25 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 78 to 259 (182 residues), 51.5 bits, see alignment E=5.4e-18

Best Hits

KEGG orthology group: None (inferred from 58% identity to smk:Sinme_2226)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QSS4 at UniProt or InterPro

Protein Sequence (275 amino acids)

>PfGW456L13_3603 Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1) (Pseudomonas fluorescens GW456-L13)
MWLRSYSTSLYLFLYAPIALIVLFSFNAGRSGLAFQCCSVQWFGTAFGNPFIMEALGNSA
LIAFSSAVIATLFGTLAVFGLQRCGAKVRMLFDALTYCAIIVPGIVIGISTLIAFISLFD
LINPLLASWLPTVPKLNMGFFTVIAAHSLFTMALVMVIVRSRVDSLDKALLEASADLYAP
PMDTFWRVTLPQISPAIMAGFLLAFTFSFDDFIIAFFVAGSETTLPIYIFSSIRRGVTPE
INAISTVIICVSLALLFTSRHLQNRRTGVQESHHA