Protein Info for PfGW456L13_3600 in Pseudomonas fluorescens GW456-L13

Annotation: Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 PF00005: ABC_tran" amino acids 26 to 169 (144 residues), 127.1 bits, see alignment E=8e-41 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 40 to 364 (325 residues), 370 bits, see alignment E=4.8e-115 PF08402: TOBE_2" amino acids 288 to 366 (79 residues), 49.4 bits, see alignment E=4.2e-17

Best Hits

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QN19 at UniProt or InterPro

Protein Sequence (371 amino acids)

>PfGW456L13_3600 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1) (Pseudomonas fluorescens GW456-L13)
VNNTPPSDIEFCNVVKRYGEVQAVGGLNFAVRRGSFHSFLGGSGCGKTTTLRMIAGFEQP
TSGEVRLAGKSVAGVPAFERPVNMVFQHYALFPHLTVAQNIAYGLRYRTPRPDKKQQLRM
ADEALEMVRLSGFGQRKPSELSGGQQQRVALARALVNKPTVLLLDEPLAALDRKLRKEMQ
SELLRLQREVGITFVLVTHDQEEALSMSDSISVMHNGSIIQTATPEQLYEAPASRYVADF
IGESNLFDGTVRQLNGNSVVLRTEQGLELTSPLTPTGKALSANTAGCIAVRPELISIAGA
NAEMTREVKLSGCVEDRIYLGNSTEYRVRTQAFGVVCVRVPRQQDHGANAFEHGAAVRVG
WDHANGLAMAL