Protein Info for PfGW456L13_3597 in Pseudomonas fluorescens GW456-L13

Annotation: fosmidomycin resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 56 to 81 (26 residues), see Phobius details amino acids 92 to 126 (35 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 266 to 283 (18 residues), see Phobius details amino acids 295 to 313 (19 residues), see Phobius details amino acids 319 to 340 (22 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details amino acids 381 to 400 (20 residues), see Phobius details PF07690: MFS_1" amino acids 31 to 365 (335 residues), 123 bits, see alignment E=7e-40 amino acids 233 to 401 (169 residues), 49 bits, see alignment E=2.2e-17

Best Hits

Swiss-Prot: 58% identical to FSR_ECOLI: Fosmidomycin resistance protein (fsr) from Escherichia coli (strain K12)

KEGG orthology group: K08223, MFS transporter, FSR family, fosmidomycin resistance protein (inferred from 89% identity to psa:PST_1311)

MetaCyc: 58% identical to fosmidomycin efflux pump (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-41

Predicted SEED Role

"fosmidomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QSE9 at UniProt or InterPro

Protein Sequence (406 amino acids)

>PfGW456L13_3597 fosmidomycin resistance protein (Pseudomonas fluorescens GW456-L13)
MSTTTLSSPSPTASVASQASPLVMRVIGACALAHLINDLIQAVLPSIYPMLKASYGLSFT
QVGLITLTFQLTASLLQLWIGFYTDRHPKPWLLPAGMVCTLIGILMLSMVGSFPAILVAS
ALVGVGSSTFHPETSRVARLASGGRYGLAQSTFQVGGNAGSAFGPLLAAAIIIPYGQGNV
AWFGLFAVFAILVQYGLSRWYRNHLNLFKLKQGSKATHGLSKRRVTFALVVLALLVFSKY
FYMASFTSYFTFYLIEKFDLSVASSQLYLFLFLGAVAAGTFFGGPIGDRIGRKQVIWFSI
LGAAPFTLALPYVDLFWTGVLSMIIGFILASAFSAIVVFAQELVPGNVGMIAGVFFGLMF
GFGGIGAALLGHLADIHGIEYVYTLCSFLPLLGILTILLPSTRSAR