Protein Info for PfGW456L13_3500 in Pseudomonas fluorescens GW456-L13

Annotation: Sensory box transcriptional regulator, LuxR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 PF13188: PAS_8" amino acids 14 to 54 (41 residues), 29.6 bits, see alignment 7.3e-11 PF08448: PAS_4" amino acids 22 to 138 (117 residues), 28.6 bits, see alignment E=2.1e-10 PF00196: GerE" amino acids 142 to 197 (56 residues), 65.1 bits, see alignment E=5.2e-22

Best Hits

Predicted SEED Role

"Sensory box transcriptional regulator, LuxR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>PfGW456L13_3500 Sensory box transcriptional regulator, LuxR family (Pseudomonas fluorescens GW456-L13)
MSQHVLTSEANRRQLQQIIAGLSDGVILLDPDQSILWANEAALAMHGASQISDLGSNAKA
YVKRFALRYRNNHLVPADSYPISRVARGETFSDVLVEVTSAGNEAYTWVHRVRSLVLVDG
RGKPESLVLIMDDVTDRASTGQLTARERDVLGLICEGLADKDIAARLKLAPNTVRNHVAT
VYSKLNVRSRSEAIVWARERGTVLW