Protein Info for PfGW456L13_350 in Pseudomonas fluorescens GW456-L13

Annotation: Protein export cytoplasm chaperone protein (SecB, maintains protein to be exported in unfolded state)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00809: protein-export chaperone SecB
  • amino acids 12 to 147 (136 residues), 182.4 bits, E=2.1e-58
• PF02556: SecB
  • amino acids 12 to 150 (139 residues), 189.8 bits, E=1.1e-60

Best Hits

Swiss-Prot: 94% identical to SECB_PSEPF: Protein-export protein SecB (secB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03071, preprotein translocase subunit SecB (inferred from 94% identity to pfo:Pfl01_0336)

Predicted SEED Role

"Protein export cytoplasm chaperone protein (SecB, maintains protein to be exported in unfolded state)"

Sequence Analysis Tools

See A0A0N8NXJ1 at UniProt or InterPro

Protein Sequence (161 amino acids)

>PfGW456L13_350 Protein export cytoplasm chaperone protein (SecB, maintains protein to be exported in unfolded state) (Pseudomonas fluorescens GW456-L13)
MTDQQNTAANEEETAPQFSLQRIYVRDLSFEAPKSPAIFRQQWEPSVALDLNTRQKTLEA
DFHEVVLTLSVTVKNGDEVAFIAEVQQAGIFLIKNLDDASMSHTLGAFCPNILFPYARET
LDSLVTRGSFPALMLAPVNFDALYAQELQRMQAAGETPTVQ