Protein Info for PfGW456L13_3471 in Pseudomonas fluorescens GW456-L13

Annotation: Transcriptional regulator, IclR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 PF09339: HTH_IclR" amino acids 9 to 60 (52 residues), 51.9 bits, see alignment 1e-17 PF12802: MarR_2" amino acids 14 to 62 (49 residues), 28.1 bits, see alignment 3.7e-10 PF01614: IclR" amino acids 125 to 247 (123 residues), 120.3 bits, see alignment E=1e-38 PF08450: SGL" amino acids 277 to 499 (223 residues), 91.2 bits, see alignment E=1.7e-29

Best Hits

Predicted SEED Role

"Transcriptional regulator, IclR family" in subsystem Homogentisate pathway of aromatic compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QST5 at UniProt or InterPro

Protein Sequence (535 amino acids)

>PfGW456L13_3471 Transcriptional regulator, IclR family (Pseudomonas fluorescens GW456-L13)
MKAGEGTGALEKALDVLEAVGSAPRGVSQAELAGQLELPKTTLYRIIASLVERGMIRRDP
VHKVYRLGFRYLELVRNAYLMPDLVAAASFELRALRDLTGETSYLAVLDGNQVRSLERCD
GAHTTRSAAALGQSKPVYCTGQGKAILAAMDEAAREAIIKGLVLTPLTELTITDRRRLHT
ELQITRARGYAIDDEEIVMGVRCVAAAIRDNAGNVRGALSVAGPAYRLTLERLELLGPEI
SEAARRVGAQLSEPRIQIGDTDVKLVDSPWAFNGAFPRWSSKLRCLFWADTLAPAIRMLD
GDGERIFARLESPVVAMELHSQGLLVAHTQGWSLIDFEGCEHPLPDWPGKSLLGLCSRPD
GSVWACLASHTGCKVGELNRHGDLRLSWEFQENITSMCWDERGQAFYAIGPETGSVYVVQ
AGSVNVRRLATLPKGSGRLSGLALDREGGVWTTLRDGWSLVRFAEDGSIDRMIGLPIPGP
TDLAFGGEDRDTLYITSARHDIPMEMLNNAPGSGHLFSIYVEHGGALANITEWTV