Protein Info for PfGW456L13_3457 in Pseudomonas fluorescens GW456-L13

Annotation: GTP cyclohydrolase I (EC 3.5.4.16) type 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF01227: GTP_cyclohydroI" amino acids 7 to 183 (177 residues), 256.3 bits, see alignment E=6.1e-81 TIGR00063: GTP cyclohydrolase I" amino acids 8 to 183 (176 residues), 258.9 bits, see alignment E=9.7e-82

Best Hits

Swiss-Prot: 86% identical to GCH11_PSEAE: GTP cyclohydrolase 1 1 (folE1) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01495, GTP cyclohydrolase I [EC: 3.5.4.16] (inferred from 89% identity to pmk:MDS_3591)

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 1" in subsystem Folate Biosynthesis or Molybdenum cofactor biosynthesis or Pterin biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.16

Use Curated BLAST to search for 3.5.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QSE2 at UniProt or InterPro

Protein Sequence (185 amino acids)

>PfGW456L13_3457 GTP cyclohydrolase I (EC 3.5.4.16) type 1 (Pseudomonas fluorescens GW456-L13)
MNEELARNYREILHGVGENPEREGLLDTPKRAAKAMQYLCHGYQQSLEQIVNGALFESDN
DEMVIVRDVELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKIARIVDMFARRLQIQENLT
RQIADAIAQVTDAAGVAVVIEAKHMCMMMRGVEKQNSVMSTSVMLGAFRESYNTRQEFLQ
LIRGR