Protein Info for PfGW456L13_3443 in Pseudomonas fluorescens GW456-L13

Annotation: putative cytochrome P450 hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 241 to 262 (22 residues), see Phobius details PF00067: p450" amino acids 206 to 381 (176 residues), 89.5 bits, see alignment E=1.1e-29

Best Hits

Predicted SEED Role

"putative cytochrome P450 hydroxylase" in subsystem Nitric oxide synthase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QQH8 at UniProt or InterPro

Protein Sequence (426 amino acids)

>PfGW456L13_3443 putative cytochrome P450 hydroxylase (Pseudomonas fluorescens GW456-L13)
MNYPAEASTPVPAHIPMHLVRDFDLWAELTTQGENAYAWAAALHQTTPPIFWIPRLGFLP
GTWVPRRAEDLRRILQDPQTFSSVGLTPYAMLLGESWRLAPLEIDPPEHVKYRALLNPLF
TPKKVEALEQDIRLLANQLIDEVVAQGRCDFNEAFAKPFPTLIFLTLMGWPLDDRPLFQH
WTQTLIKSFDMQTVTDNARAITTWIRNHIAERRANPGDDFTSYLLTSEIDGRPLTDDEML
GINFLIFIAGLDTVTSCLGLFFRHLARSPEQQAQLRANPELIGDAVEELLRSYSIVNMRR
TVTCDVQIGEVMMKKGDMVLISTELANLDPEVFDEADKVDFQRSAGASPHMAFSYGVHRC
VGSHLARRELRIAMELWLQRLPAFRIADNSTPRFNAFGVFGMEDLHLQWDLPAATANTSN
KQAASA