Protein Info for PfGW456L13_3426 in Pseudomonas fluorescens GW456-L13

Annotation: 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF00106: adh_short" amino acids 9 to 200 (192 residues), 166.5 bits, see alignment E=8.1e-53 PF08659: KR" amino acids 12 to 168 (157 residues), 41.1 bits, see alignment E=2.9e-14 PF13561: adh_short_C2" amino acids 19 to 252 (234 residues), 193.5 bits, see alignment E=6.6e-61

Best Hits

Swiss-Prot: 38% identical to Y2146_BRADU: Probable short-chain type dehydrogenase/reductase blr2146 (blr2146) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: None (inferred from 62% identity to gag:Glaag_0401)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QSI5 at UniProt or InterPro

Protein Sequence (273 amino acids)

>PfGW456L13_3426 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100) (Pseudomonas fluorescens GW456-L13)
MSTGKLAGRVAIITGSGGGLGAECARVLASHGASIAVVDINFEGATAVAQSLVAEGHQAL
AIATDVSSEDDVRAMVAQVKERFGRIDILHNNAAILNAEQRQLDRDFVNLDMQAWDRAIA
VNLRGAVLCTKHVIPVMLENGKGSIIFATSGLGMQGDMSLTGYATSKAGLMMLPRMVASQ
YGKQGIRGNAVQIGLAPSEHAMPEPLLDILRDNHCTAELGTPRQIADVVAFLASDESSFV
TGTTLVADGGFSSHTPSLVAMRALFAQMGRTGM