Protein Info for PfGW456L13_3400 in Pseudomonas fluorescens GW456-L13

Annotation: Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 174 to 196 (23 residues), see Phobius details PF00501: AMP-binding" amino acids 1 to 337 (337 residues), 198.3 bits, see alignment E=1.9e-62 PF13193: AMP-binding_C" amino acids 387 to 461 (75 residues), 43.3 bits, see alignment E=5.8e-15

Best Hits

KEGG orthology group: None (inferred from 76% identity to bxe:Bxe_C0592)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QRW1 at UniProt or InterPro

Protein Sequence (490 amino acids)

>PfGW456L13_3400 Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3) (Pseudomonas fluorescens GW456-L13)
MANALATLGVKAGETVLTMLDNNIDAVTTWLAINKLCAVSVPINTALKGEFLRHQIADTG
TSVVICEAAYLPRITPLAEQLLDVQHILHRGTADAIPDCRIRIAPLDEWRGHDATPLANK
PQPSDLACLIYTSGTTGPSKGCMISYNFMCNLARLQLRAGPASADDVTITPLPLFHMNAL
CVSIIASILVGARAAILPRFSVSNFWQEVERSGATIASILGGMGGLLAQAPDNEAMLRCV
GQIHTARGNPYTEETKKIWRERFGTKLVGGNGYGLTEACVITSLAAGEYAAPGSSGKRIS
DFDVRIVDDLDQEVAPNSAGEIVVRPLRPDIMFQGYWRRPEDTQKLMRNMWFHTGDIGKF
DDDGFFYFVDRKKDYLRRRGENISSFEMEAAFAVHPALAEVAVHAVPSDKGEDDVKVTAV
LHEGMTLDPEQLFHWATESVPYYALPRYIEFRSSLPKNPQGRVLKYLLRDEGKTATTWDL
ETTSIVVSKK