Protein Info for PfGW456L13_3395 in Pseudomonas fluorescens GW456-L13

Annotation: 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02737: 3HCDH_N
  • amino acids 7 to 186 (180 residues), 191 bits, E=1.8e-60
• PF00725: 3HCDH
  • amino acids 191 to 284 (94 residues), 100.4 bits, E=6.7e-33

Best Hits

Swiss-Prot: 42% identical to HBD_THETC: 3-hydroxybutyryl-CoA dehydrogenase (hbd) from Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIB 9385 / NCA 3814)

KEGG orthology group: K00074, 3-hydroxybutyryl-CoA dehydrogenase [EC: 1.1.1.157] (inferred from 73% identity to bxe:Bxe_C0596)

Predicted SEED Role

"3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35)" (EC 1.1.1.157, EC 1.1.1.35)

MetaCyc Pathways

• oleate β-oxidation (30/35 steps found)
• fatty acid salvage (6/6 steps found)
• adipate degradation (5/5 steps found)
• superpathway of phenylethylamine degradation (9/11 steps found)
• 2-methyl-branched fatty acid β-oxidation (11/14 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• phenylacetate degradation I (aerobic) (7/9 steps found)
• valproate β-oxidation (7/9 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (4/5 steps found)
• adipate biosynthesis (4/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• fatty acid β-oxidation I (generic) (5/7 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (6/10 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
• glycerol degradation to butanol (10/16 steps found)
• 4-hydroxybenzoate biosynthesis III (plants) (2/5 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• androstenedione degradation I (aerobic) (16/25 steps found)
• benzoyl-CoA degradation I (aerobic) (3/7 steps found)
• pyruvate fermentation to butanoate (3/7 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• superpathway of testosterone and androsterone degradation (17/28 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• 2-methylpropene degradation (2/8 steps found)
• L-tryptophan degradation III (eukaryotic) (7/15 steps found)
• 3-phenylpropanoate degradation (3/10 steps found)
• methyl tert-butyl ether degradation (3/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
• L-glutamate degradation VII (to butanoate) (3/12 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (4/16 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (4/17 steps found)
• toluene degradation VI (anaerobic) (4/18 steps found)
• cholesterol degradation to androstenedione I (cholesterol oxidase) (2/17 steps found)
• androstenedione degradation II (anaerobic) (9/27 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (18/42 steps found)
• platensimycin biosynthesis (6/26 steps found)
• cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (3/22 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (19/47 steps found)
• superpathway of cholesterol degradation III (oxidase) (10/49 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Bile acid biosynthesis
• Biosynthesis of plant hormones
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Lysine degradation
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.157, 1.1.1.35

Use Curated BLAST to search for 1.1.1.157 or 1.1.1.35

Sequence Analysis Tools

See A0A293Q2C8 at UniProt or InterPro

Protein Sequence (300 amino acids)

>PfGW456L13_3395 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) (Pseudomonas fluorescens GW456-L13)
MNANKEKVVVVGAGLMGTGIAHAFASAGFNTLLVDTNAASLTSARTSIEKILADGVRLGK
VSEEQAQQSLANLLTCSDLSEAAMGANWLVETVSEQLAVKKAVIGQAAPLLAADAIIATN
TSALSVTEIAASVDCADRVIGMHFFNPVHKMKLVELVRGLATSDEVVARTRILCEQINKT
SIVVNESPGLTTSRMSALLGNEAMWMLQEGTATAEDIDTALRLGFNHPMGPLELGDLTGW
DTRLSVLRYLHQTLGEKFRPCPLIIKMVAAGRLGRKSGHGVYRYEEGKQVPGSGLKASAL