Protein Info for PfGW456L13_3385 in Pseudomonas fluorescens GW456-L13

Annotation: Pantoate--beta-alanine ligase (EC 6.3.2.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 TIGR00018: pantoate--beta-alanine ligase" amino acids 1 to 281 (281 residues), 317 bits, see alignment E=4.4e-99 PF02569: Pantoate_ligase" amino acids 3 to 278 (276 residues), 340.3 bits, see alignment E=3.4e-106

Best Hits

Swiss-Prot: 62% identical to PANC_PSEF5: Pantothenate synthetase (panC) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K01918, pantoate--beta-alanine ligase [EC: 6.3.2.1] (inferred from 62% identity to pfl:PFL_5278)

Predicted SEED Role

"Pantoate--beta-alanine ligase (EC 6.3.2.1)" in subsystem Coenzyme A Biosynthesis (EC 6.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.1

Use Curated BLAST to search for 6.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QRB5 at UniProt or InterPro

Protein Sequence (293 amino acids)

>PfGW456L13_3385 Pantoate--beta-alanine ligase (EC 6.3.2.1) (Pseudomonas fluorescens GW456-L13)
VQTVDTVGALRALVARARGENKKVALVPTMGNLHDGHIALIHCAKQRADFVVASIFVNPL
QFGANEDLANYPRTPDADRERLVNAGCDVLFAPAVEQIYPDGMLNQAIVSVPNASEGLCG
AARPGHFDGMATVVAKLLNIAQPDVAVFGEKDYQQLAVVRSMVRDLNMVTDVVGAPTIRA
ADGLALSSRNGYLTEHERSVAPVLYACLKQMAASIQLERRVAERQLIECHQRISDAGFQL
EYFEVRNAQDLTPVKSTDTHFVILVAARIGKTRLIDNLTVDLRASETSPEEQQ