Protein Info for PfGW456L13_3366 in Pseudomonas fluorescens GW456-L13

Annotation: ADA regulatory protein / Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF02805: Ada_Zn_binding" amino acids 2 to 63 (62 residues), 102.5 bits, see alignment E=2e-33 PF12833: HTH_18" amino acids 98 to 167 (70 residues), 66.9 bits, see alignment E=3.2e-22 PF01035: DNA_binding_1" amino acids 257 to 336 (80 residues), 114.2 bits, see alignment E=4e-37 TIGR00589: methylated-DNA--[protein]-cysteine S-methyltransferase" amino acids 257 to 335 (79 residues), 105.7 bits, see alignment E=5e-35

Best Hits

KEGG orthology group: K10778, AraC family transcriptional regulator, regulatory protein of adaptative response / methylated-DNA-[protein]-cysteine methyltransferase [EC: 2.1.1.63] (inferred from 84% identity to pfo:Pfl01_2158)

Predicted SEED Role

"ADA regulatory protein / Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63)" in subsystem DNA repair, bacterial (EC 2.1.1.63)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.63

Use Curated BLAST to search for 2.1.1.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QSL7 at UniProt or InterPro

Protein Sequence (347 amino acids)

>PfGW456L13_3366 ADA regulatory protein / Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63) (Pseudomonas fluorescens GW456-L13)
MVRAMLERDTSYEGVFFTAVKTTGIFCRPGCTARSPKPENVEFFASAEQCLAAGYRACKR
CKPLDTAASAPDWVQKLFKSVDADPEQRWTDARLLAEGIEPLKLRRWFKQHFGMTFHAWL
RTRRLGMALGGIKQGDSIDDVAFDSGYESLSGFRDAFQKSFHITPGRAANSEPLLFTRLT
TPLGPMIAMAERRGLVLLEFLDQASLNPSVQALQNRFGYAVAPGHNAHLQQIEEQLSAYF
AGTLTEFSVALHMPGSEFSRRVWAELAKIPYGRTTTYGAIAAILGKPGASRAVGLANGHN
RLSIVVPCHRVIGADGSLTGYAGGQPRKAFLLRLENAAVQLTEQLAF