Protein Info for PfGW456L13_3362 in Pseudomonas fluorescens GW456-L13

Annotation: Transporter, LysE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 136 to 161 (26 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details PF01810: LysE" amino acids 10 to 191 (182 residues), 89 bits, see alignment E=1.4e-29

Best Hits

KEGG orthology group: None (inferred from 84% identity to pfo:Pfl01_2164)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QS45 at UniProt or InterPro

Protein Sequence (192 amino acids)

>PfGW456L13_3362 Transporter, LysE family (Pseudomonas fluorescens GW456-L13)
MMSMAAFALVASITPGPVNIVALSSGARFGFRASQRHVAGATLGFVLLLVLMGLGLHELL
QRWPALTQGVQWAGVAFLLYMAFKLAADNGQVQTSESAQAPSMLYGAIMQWLNPKAWLAC
VAGMGAFVADGEARLVWQFAAIYLVICYASVGCWAYAGTFLRGFLHNPAGMRLFNRTMAL
LLVVSAVYLLLP