Protein Info for PfGW456L13_3359 in Pseudomonas fluorescens GW456-L13

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 829 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF07660: STN" amino acids 76 to 119 (44 residues), 34.5 bits, see alignment 2.2e-12 PF07715: Plug" amino acids 165 to 265 (101 residues), 73.2 bits, see alignment E=3.6e-24 TIGR01783: TonB-dependent siderophore receptor" amino acids 167 to 829 (663 residues), 330.1 bits, see alignment E=1.6e-102 PF00593: TonB_dep_Rec_b-barrel" amino acids 355 to 798 (444 residues), 179.2 bits, see alignment E=4.2e-56

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 74% identity to pfs:PFLU3633)

Predicted SEED Role

"TonB-dependent siderophore receptor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QME8 at UniProt or InterPro

Protein Sequence (829 amino acids)

>PfGW456L13_3359 TonB-dependent siderophore receptor (Pseudomonas fluorescens GW456-L13)
MPRATVTRTRFALHPLMLALAVVLPGLDVSRTQAAPLVNSEQPGSQARHYTIAAGSLVSV
LNRFAEQAGIFLAGHNDLAAGKRSPGLDGVYSQQQALQRLLQGSGLQAQRQGTGSYVLQA
TAVTQEALELGATNISGQAPGTISEDSRAYTVGSTSSATGLPLSLRETPQSVTVITRQLM
DDQGATSIVDVLRRTPGISVQNYDSERWEFSSRGLPITNFQYDGVNTDYDGVYDYGTSST
DMAPYDRVEIIKGATGLMTGAGDPSATVNLIRKRPTPAFKASVTGTVGSWDNYRSEGDVS
GPLSASANVRGRLVGVHQDRSAYTDHYRSTKDIAYGIVEADLTPDTLVTVGIDQQDTRSR
GASWTGFPMYYSDGSRTDFSRSFNPATDWSRRDFTNQTVFASVQQQLVNDWALKVSYDRK
HRQHDTFLASASGGNPDPVSGNGMFMYMGKFEGDQVQDNIDVNLTGPFTLWGGDHELIVG
FMSMNTRQDIPVYGSVYPPVDGSIFDWRGEFAKPGIPRVGTNDIVQRQTGAYLATRLKPV
DDLALILGTRVSDFSGHDDLDYSDPHTADLRDSYRQSGVVTPYAGLVYDFDDTWSVYTSY
TSIYQPQMSKDANRRLLDPVQGKSLEAGIKAEYFDGRLNARFALYRIEQDNIAEYVSGVD
TESVYRAVQGATTKGFEIELAGELRDGWNLSAGYTYNHTRDAKGDYVYGSVLQTTAPEQV
VRVFSTYRLPGPWDRLTVGAGVNWQSEFFGNVFRPDPADTVNFGQYTTITQPGYALVDAM
ARYRFNEHLSTTLNVKNLFDKTYYTGLGNFGTGFYGEPRAVQLTTRWAF