Protein Info for PfGW456L13_3303 in Pseudomonas fluorescens GW456-L13

Annotation: BatA (Bacteroides aerotolerance operon)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details PF00092: VWA" amino acids 91 to 282 (192 residues), 73 bits, see alignment E=5.4e-24 PF13519: VWA_2" amino acids 93 to 203 (111 residues), 61.4 bits, see alignment E=1.8e-20

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 88% identity to pfo:Pfl01_3211)

Predicted SEED Role

"BatA (Bacteroides aerotolerance operon)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QQ49 at UniProt or InterPro

Protein Sequence (360 amino acids)

>PfGW456L13_3303 BatA (Bacteroides aerotolerance operon) (Pseudomonas fluorescens GW456-L13)
MFEFAWPWIFALLPLPWLMRIILPVADSGEPALKVSFLSDLEGLAGRRARANLPAWRQQA
PFIVLWLLLLVAAARPQWLGEPLPIAASGRDLLVAVDVSGSMDFPDMQWQDEEVSRLALV
QHLLGDFLESREGDRVGLILFGSQAYLQAPLTFDRHTVRVWLDEARIGIAGKNTAIGDAI
GLALKRLRSRPATSRVLILVTDGANNGGEIDPFTAARLAAKEGVKIYPIGIGADPEQSGS
VGFLGVNPSLDLDEPSLKAIAEVTGGQYFRAHDGKELQSIKDTLDQLEPVTQQPTQARPA
QALYHWPLALALWLSMLLLAPVLWPDNPLQRLFTRDLFLQTQLLPDWRQRLKRLRLRRRR