Protein Info for PfGW456L13_3283 in Pseudomonas fluorescens GW456-L13

Annotation: probable deca-heme c-type cytochrome

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 786 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details PF13435: Cytochrome_C554" amino acids 81 to 108 (28 residues), 17.2 bits, see alignment (E = 5.6e-06) amino acids 209 to 249 (41 residues), 23.4 bits, see alignment 6.5e-08 PF09699: Paired_CXXCH_1" amino acids 343 to 373 (31 residues), 25.8 bits, see alignment (E = 4.4e-09) PF13181: TPR_8" amino acids 613 to 645 (33 residues), 12.3 bits, see alignment (E = 0.00011) amino acids 686 to 713 (28 residues), 13.9 bits, see alignment (E = 3.3e-05) PF07721: TPR_4" amino acids 617 to 637 (21 residues), 11.5 bits, see alignment (E = 0.00027) amino acids 718 to 740 (23 residues), 15 bits, see alignment (E = 2e-05) PF14559: TPR_19" amino acids 625 to 680 (56 residues), 28.8 bits, see alignment 8.5e-10 amino acids 691 to 746 (56 residues), 32.7 bits, see alignment 5e-11 PF13432: TPR_16" amino acids 659 to 714 (56 residues), 19.2 bits, see alignment 9.5e-07 amino acids 720 to 768 (49 residues), 18.1 bits, see alignment 2.2e-06

Best Hits

KEGG orthology group: None (inferred from 72% identity to pfl:PFL_2837)

Predicted SEED Role

"probable deca-heme c-type cytochrome"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QM80 at UniProt or InterPro

Protein Sequence (786 amino acids)

>PfGW456L13_3283 probable deca-heme c-type cytochrome (Pseudomonas fluorescens GW456-L13)
MPKHKNKAATPNPDSQPTLINRYLFPVTIGILLLAVAGIGWFLLGSTPTPLKPVPVSAPA
VQPAKPQPVAVKPAKMVDEQQCQGCHGEQVKDWQGSHHQLAMQQANADTLLGDFNNVTFK
AEKETTVFSRKGDEFWVNTPGIDGKNADFKVAYTFGIAPLQQYLIEVGEGRLQALGVAWD
TEKQRWFHLYPGQGVTFKNPLHWSKPSQNANFMCVECHTTGYKRNFDAAKNTFDSHWNSL
GVGCQACHGPASNHLEWTAKKTDLIHVGFAVDLKDKNATVEIETCARCHSRRAPLDDGYT
VGKRLMDDYLPSVLTRELYALDGKIKDEVFEHGSFAQSKMFDKGVRCSNCHNPHSTQLKA
PDNGVCLQCHNTAGKTTVEGVDGKGLQAKNYDSIEHTRHTMGQPGSQCVDCHMPGKFYMG
NDLRHDHSFSIPNPERAKKLGTPDACLTCHKGKAGDKVTEQFKLWNTANASAVQAPRYDE
SLWLIRNGQPGAAQALFEQLQRSNLPAIQRATLLAELPAYPSEQALKLATRDLGNPAPQV
RESAVRAVSAFLPPAERAPLLTPLLSDPVRAVRIAVARDLLSVARNGLGSAQDAWNAAIA
EYEAVQKSLAERAEANLNLAMLYQADGRSAEVEALLRTALQRDPDFYPALVTLVQWLEAN
GRSQEAHALLGQSLKDHPDSGLLQHTQGLALIRAGQAAQAMPYLRKAAQLDPQSGQFGYV
LAVALHDSGKIDQACAELERLLKVQPANRNARLSLIQYYLDNGQEPKAQVLLQGWKKMNM
GDPALK