Protein Info for PfGW456L13_3229 in Pseudomonas fluorescens GW456-L13

Annotation: Ferric iron ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 45 to 68 (24 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 258 to 284 (27 residues), see Phobius details amino acids 304 to 326 (23 residues), see Phobius details amino acids 339 to 362 (24 residues), see Phobius details amino acids 369 to 389 (21 residues), see Phobius details amino acids 414 to 438 (25 residues), see Phobius details amino acids 471 to 491 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 62 to 222 (161 residues), 41.9 bits, see alignment E=4.6e-15 amino acids 319 to 497 (179 residues), 72.3 bits, see alignment E=2.2e-24

Best Hits

Swiss-Prot: 75% identical to FBPB_SERMA: Fe(3+)-transport system permease protein SfuB (fbpB) from Serratia marcescens

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 84% identity to pfo:Pfl01_2838)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QRT2 at UniProt or InterPro

Protein Sequence (500 amino acids)

>PfGW456L13_3229 Ferric iron ABC transporter, permease protein (Pseudomonas fluorescens GW456-L13)
VIGLSVLVSLLALLPIAYVIGVSLQTGWSTVVTLVFRPRVGELLVNTVLLVLLTIPLCVA
LGVTLAWLTERTNLPGRRWWSLLATAPLAVPAFVHSYAWVSLVPPIHGLFAGVLVSVIAY
FPFLYLPVAATLRRLDPAIEDVAESMGLKPWKVFFRVVLPQLRLAICGGALLVGLHLLAE
YGLYAMIRFDTFTTAIFDQFKSTFNGAAAHMLASVLALCCLAMLTAESAARGSARYARVG
SGSAREQRVVRLKPVSTLLSLTLQIATCALALGVPLITLGKWLIAGGVEVWDMAELLPAL
EQTLLLGIGGAALTTCAAIPIAWLSIRYPGRLQRVLESCNYITSSLPGIIVALALVTVTI
HFARPIYQTTFTVLLAYLLMFLPRALVSLRAGIAQAPVELENIARSLGRSPARALWLITL
RLAAPGAAAGAALVFLAITNELTATLLLAPNGTRTLATGFWALTSEIDYAAAAPYALLMV
VLSLPLTGLLYHQSKKTAGR