Protein Info for PfGW456L13_322 in Pseudomonas fluorescens GW456-L13

Annotation: Histidine ABC transporter, ATP-binding protein (TC 3.A.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 TIGR01186: glycine betaine/L-proline transport ATP binding subunit" amino acids 41 to 271 (231 residues), 365.5 bits, see alignment E=1.5e-113 PF00005: ABC_tran" amino acids 48 to 196 (149 residues), 115.4 bits, see alignment E=1.6e-37

Best Hits

KEGG orthology group: K02000, glycine betaine/proline transport system ATP-binding protein [EC: 3.6.3.32] (inferred from 96% identity to pfo:Pfl01_0364)

Predicted SEED Role

"Histidine ABC transporter, ATP-binding protein (TC 3.A.1)"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.32

Use Curated BLAST to search for 3.6.3.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QIR0 at UniProt or InterPro

Protein Sequence (276 amino acids)

>PfGW456L13_322 Histidine ABC transporter, ATP-binding protein (TC 3.A.1) (Pseudomonas fluorescens GW456-L13)
MNNATVSKIEVKNVFKIFGNRSKDALAMIGQGKTKDQVLAETGCVVGVNDLSLSIGSGEI
FVIMGLSGSGKSTLVRHFNRLIDPTSGAILVDGVDILQYDMEALREFRRRKISMVFQSFG
LLPHKSVLDNVAYGLKIRGESKAMCAERALHWINTVGLKGYENKYPHQLSGGMRQRVGLA
RALAADTDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTIVFITHDLDEAVRIGNRIA
ILKDGRLIQVGTPREILHSPADEYVDRFVQRRAAVV