Protein Info for PfGW456L13_3214 in Pseudomonas fluorescens GW456-L13

Annotation: probable two-component response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF00072: Response_reg" amino acids 5 to 113 (109 residues), 99.5 bits, see alignment E=1.3e-32 PF00486: Trans_reg_C" amino acids 157 to 232 (76 residues), 80.2 bits, see alignment E=9.4e-27

Best Hits

Swiss-Prot: 81% identical to ARUR_PSEAE: Transcriptional regulatory protein AruR (aruR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 90% identity to pfl:PFL_2707)

Predicted SEED Role

"probable two-component response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QRD8 at UniProt or InterPro

Protein Sequence (238 amino acids)

>PfGW456L13_3214 probable two-component response regulator (Pseudomonas fluorescens GW456-L13)
MTPRVLIVDDDPLIRDLLHAYLSQEGYDVHCAATAELAETFLASQTVDLVMLDIRLPGKD
GLTLTRELRVRSEVGIILITGRNDEIDRIVGLECGADDYVIKPLNPRELVSRAKNLIRRV
RHAQTPAPAIAAAKPVKQFADWALDTDRRRLIDPSGSETLLTHGEYQLLSVFLRNSGHTL
SRDQLMDQIRNREWVPNDRSIDVLVGRLRRKLHDDPAEPQLIITIHGAGYLFTASVAA