Protein Info for PfGW456L13_3201 in Pseudomonas fluorescens GW456-L13

Annotation: Alpha-glucoside transport ATP-binding protein AglK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 PF00005: ABC_tran" amino acids 28 to 186 (159 residues), 86.8 bits, see alignment E=3.3e-28 amino acids 293 to 445 (153 residues), 108.8 bits, see alignment E=5.3e-35

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 88% identity to pfl:PFL_5624)

Predicted SEED Role

"Alpha-glucoside transport ATP-binding protein AglK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QQV1 at UniProt or InterPro

Protein Sequence (548 amino acids)

>PfGW456L13_3201 Alpha-glucoside transport ATP-binding protein AglK (Pseudomonas fluorescens GW456-L13)
MTTSKPLLEIRNLHIEGHYEDAWHPLIKGIDLTLQRGEVLGLIGESGAGKSTLGLSAMGY
TRDGCRITGGSVHFDGIDLLNAKPEALRKLRGLRIAYVAQSAAASFNPAHRLIDQHVETA
VKNGGMSREQAMREAVELYRVLRLPNPETIGQRYPHQVSGGQLQRVMTAMAMACHPDLII
FDEPTTALDVTTQIEVLAAIRDAVATYGSAAIYISHDLAVVAQMADRIMVLRHGKLVEEA
ETRQMLGDPQEDYTKSLWAVRSFRTEPKACPQQEQPLLELRNSCASYGQQPVLHDVSLKL
YRGQTLAVIGESGSGKSSTARLITGLLPPTYGQVLYDGELLPADFRQRSKEQLRRIQMIY
QIPDTALNPRQRIVDIIGRPLTFYLGLKGKAMRARVAELLEMIELDPATFMDRQPRELSG
GQKQRICIARALAAEPQLIICDEVTSALDQLVAEGVLKLLNRIQQQLGVGYLFITHDVAT
VRAIADEVLVMQRGRVVDHGSRSQIFTPPHQDYTGLLFSSEPQMDPDWLDRLLATRASTP
STDTLEQV