Protein Info for PfGW456L13_3200 in Pseudomonas fluorescens GW456-L13

Annotation: NAD(P)H oxidoreductase YRKL (EC 1.6.99.-) @ Putative NADPH-quinone reductase (modulator of drug activity B) @ Flavodoxin 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 95 to 104 (10 residues), see Phobius details PF02525: Flavodoxin_2" amino acids 1 to 208 (208 residues), 178.1 bits, see alignment E=1.8e-56 PF03358: FMN_red" amino acids 1 to 151 (151 residues), 50.4 bits, see alignment E=2e-17

Best Hits

Swiss-Prot: 44% identical to NQO2_HUMAN: Ribosyldihydronicotinamide dehydrogenase [quinone] (NQO2) from Homo sapiens

KEGG orthology group: K00355, NAD(P)H dehydrogenase (quinone) [EC: 1.6.5.2] (inferred from 86% identity to pfl:PFL_2716)

MetaCyc: 40% identical to NAD(P)H dehydrogenase (quinone) 1 (Homo sapiens)
NAD(P)H dehydrogenase (quinone). [EC: 1.6.5.2]; 1.6.5.2 [EC: 1.6.5.2]

Predicted SEED Role

"NAD(P)H oxidoreductase YRKL (EC 1.6.99.-) @ Putative NADPH-quinone reductase (modulator of drug activity B) @ Flavodoxin 2" (EC 1.6.99.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.2

Use Curated BLAST to search for 1.6.5.2 or 1.6.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293Q1V1 at UniProt or InterPro

Protein Sequence (236 amino acids)

>PfGW456L13_3200 NAD(P)H oxidoreductase YRKL (EC 1.6.99.-) @ Putative NADPH-quinone reductase (modulator of drug activity B) @ Flavodoxin 2 (Pseudomonas fluorescens GW456-L13)
MKVLIVHAHPEPQSFTAALRDQAVATLEAQGHEVQVSDLYKMNWNPVASDADFSNRENPE
YLVYALEQRLGVKSQSLAADIQAELDKLLWADLLILNFPIFWFSTPAMLKGWIDRVLVSG
ICYGGKRFYDQGGLAGKKALVTVTLGGREHMFGEGAIHGPLEDMLRPILRGTLAYVGFDV
LEPFVAWHVPYISDEARQQFLVDYGQRLQHLSDDQPLVFPKLAEFDDKLYPLTTNA