Protein Info for PfGW456L13_3196 in Pseudomonas fluorescens GW456-L13

Annotation: diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 transmembrane" amino acids 209 to 229 (21 residues), see Phobius details PF00563: EAL" amino acids 239 to 468 (230 residues), 197 bits, see alignment E=1.7e-62

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QM07 at UniProt or InterPro

Protein Sequence (499 amino acids)

>PfGW456L13_3196 diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (Pseudomonas fluorescens GW456-L13)
LADQFVARKLNNVYADLRAAQVEPNAQIDKVLETLGDLDRSGQECSVEQYSQLADLVKNL
RFVDQAAIQLPNGKICSSNGQAPPSILADSDKRKFSVGKRTYWVDAGHTVSADTDFIIVS
EQSTYVWANKKLLLDNLKFPKDLQLDLIGPGGAVPIASTGHKPLTVQKPFHLEELVTSAD
KVLIAFAGNRNELISVISLPLSYLTSLKFKLFIGLVCVFAALFLLAWCVKRHYTSTAVRL
RNALKANRLDVHYQPIVNLTTGYLVGAESLSRWNDNGTQVPADVFIAVAEKSDLIRVLTR
SVIRQVAEDYSTYLWACKDFYITVNLCAQDIQDPSFPDYVASVLATYNMPVSAMAFEITE
RTLIDQKPAALQLRRLRACGHRIAVDDFGIGYSNLSLLDSVPFDILKLDRSFIADDKIAA
KDALWRHIAQLARSLRLKVVAEGVETQEQLPHLVSEGVLLAQGWLFSKALPIQALARRYF
QCPENIPPYDSKISINDFY