Protein Info for PfGW456L13_3174 in Pseudomonas fluorescens GW456-L13

Annotation: Thermostable hemolysin delta-VPH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 60 to 76 (17 residues), see Phobius details amino acids 129 to 152 (24 residues), see Phobius details PF12261: T_hemolysin" amino acids 29 to 199 (171 residues), 199.8 bits, see alignment E=1.6e-63

Best Hits

KEGG orthology group: None (inferred from 79% identity to pfo:Pfl01_3349)

Predicted SEED Role

"Thermostable hemolysin delta-VPH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QRU7 at UniProt or InterPro

Protein Sequence (225 amino acids)

>PfGW456L13_3174 Thermostable hemolysin delta-VPH (Pseudomonas fluorescens GW456-L13)
MSDFNWNVQLPLHFGLTEAQQMYLVRALPDAPQRSAFEAFIQQRFRKAHSADIRHFMPEL
FGMSEASGALCAVIGVRLARSGPLFLEGYLDDPIDPLISAAADQTVSRSAIVEVGNLAAS
DTGSARMSIIAMTYLLAMGGLEWVAFTGNLGLVNSFHRLGLKPVTLCAADPARLGEDRHA
WGSYYESKPWVHFGNVRSGFIHLRNIGLFSRLGLPTSIEGACHVA