Protein Info for PfGW456L13_3148 in Pseudomonas fluorescens GW456-L13

Annotation: L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 47 to 66 (20 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 139 to 165 (27 residues), see Phobius details amino acids 212 to 238 (27 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 110 to 269 (160 residues), 83.5 bits, see alignment E=8e-28

Best Hits

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 85% identity to pba:PSEBR_a3616)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QRY5 at UniProt or InterPro

Protein Sequence (283 amino acids)

>PfGW456L13_3148 L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1) (Pseudomonas fluorescens GW456-L13)
MSSAEIHFSPGAFLAPAVDWLNANLHGLFKVISQVIEAVLGGVEGALLAPHPYALIGGVV
VLALFFANKKVALFAGLMLAFCLFSGLWVASMQTIALVSVAVLISVSIAFPLGVLAARVK
RVDEAFLPILNIMQTVPPWVYLIPAVMLFSLGRVPAIIATIVYGIPPMLRLTTLAFKQLP
KEFLELGQAIGASPRAILFKIELPTAAPTLLVGLNQCILLSLAMVVLAGLVGAGGLGAEV
TRGLTRMEMGLGLRAGLAIVAVALLLDRLSRGALQRHSPRKLV