Protein Info for PfGW456L13_3135 in Pseudomonas fluorescens GW456-L13

Annotation: Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF08240: ADH_N" amino acids 28 to 101 (74 residues), 42.1 bits, see alignment E=1e-14 PF00107: ADH_zinc_N" amino acids 154 to 232 (79 residues), 62.2 bits, see alignment E=7.5e-21 PF13602: ADH_zinc_N_2" amino acids 185 to 303 (119 residues), 74.8 bits, see alignment E=2e-24

Best Hits

KEGG orthology group: None (inferred from 75% identity to pfl:PFL_2373)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QVH1 at UniProt or InterPro

Protein Sequence (307 amino acids)

>PfGW456L13_3135 Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase (Pseudomonas fluorescens GW456-L13)
MKALRVYEYGSPEVLRLEEIADPVAGVGEVLIDVAGAGVNPIDWKILSGAMKAFIPLPLP
FTPGVEVAGTVAALGEGVTEFNIGDEVFGFINIVGGYATKAVAQVSKLAIKPKSLSALQA
GAVPATALTAWQALTEHAGVQRRQKVLIHAAAGGVGSMAVQIAKYLGAEVYATASAHHHA
YLKEIGADYTIDYRTQAFEELVSGLDVILDLVGGETQTRSFAVLKKHGVLVSPVSAPNMS
LANDYGVTPANFATRSDGRQLSLIAELFDKGHLTVDVETYPLSEAKVAIEKSMGRHLRGR
LVLDTAK